PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.L12RP
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family TALE
Protein Properties Length: 357aa    MW: 40565.7 Da    PI: 6.1885
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.L12RPgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.41.4e-092823191855
                  HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
     Homeobox  18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                    +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Araip.L12RP 282 RHHKWPYPSESQKVALAESTGLDQKQINNWFINQRKRH 319
                  445679*****************************885 PP

2ELK41.13.6e-14239260122
          ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                  ELK qLlrKYsgyLgsLkqEF+
  Araip.L12RP 239 ELKGQLLRKYSGYLGSLKQEFM 260
                  9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.0E-20103147IPR005540KNOX1
PfamPF037908.4E-23104143IPR005540KNOX1
SMARTSM012564.5E-24150201IPR005541KNOX2
PfamPF037915.1E-20153199IPR005541KNOX2
PfamPF037895.9E-11239260IPR005539ELK domain
PROSITE profilePS5121311.174239259IPR005539ELK domain
SMARTSM011882.8E-8239260IPR005539ELK domain
PROSITE profilePS5007113.086259322IPR001356Homeobox domain
SMARTSM003897.2E-14261326IPR001356Homeobox domain
SuperFamilySSF466893.68E-19261336IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-28264324IPR009057Homeodomain-like
CDDcd000861.44E-12271323No hitNo description
PfamPF059201.2E-16279318IPR008422Homeobox KN domain
PROSITE patternPS000270297320IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009934Biological Processregulation of meristem structural organization
GO:0048440Biological Processcarpel development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MEEEGNGTYS MMAFGENIMS TSNNSGIYPI IMMPLLTTPV INPLPNLNYS NPNNTSNDNA  60
DTNSSFPLPM LTTHQEPIRN NTGICYFMDI HNNHHGSSSS SSSALKAKIM SHPHYHRLLA  120
AYVNCQKVGA PPEVVARLEE ACESAAAMAA TSCIGEDPAL DQFMEAYCEM LIKYEQELSK  180
PFKESMLFLQ RMESQFKSLS ISPSNNFAGN EGVDRNGSSE DDVDLQNNAI IDPQAEDREL  240
KGQLLRKYSG YLGSLKQEFM KKRKKGKLPK EARQQLLEWW SRHHKWPYPS ESQKVALAES  300
TGLDQKQINN WFINQRKRHW KPSEDMQFVV MDQSHPHYYI DNVVANPFPM DFSHTML
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1254263LKQEFMKKRK
2260264KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016195470.10.0PREDICTED: homeobox protein SBH1 isoform X1
SwissprotP466081e-154HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLD3IWE91e-168D3IWE9_PRUPE; Class I KNOX homeobox transcription factor STM-like 2
STRINGGLYMA07G39350.11e-155(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-130KNOX/ELK homeobox transcription factor